PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 497aa    MW: 53362 Da    PI: 5.3354
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085751.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-39142202262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  XP_011085751.1 142 PDKILPCPRCNSMETKFCYFNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSSA 202
                     7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31139199IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31144200IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.518146200IPR003851Zinc finger, Dof-type
PROSITE patternPS013610148184IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MFEVKDPKIK LFGKTIELPE TCAAAVEIGE AAQSCDAAGE DSSNQDPSCS SDSMIDNSNL  60
NGDAEDHESH KCQSVPKQND GKEEDVAHPS TSNELKEDAT PAADEDSKAL SADSDARAVQ  120
TSKTEDDQIE TGNSQEKTLK KPDKILPCPR CNSMETKFCY FNNYNVNQPR HFCKKCQRYW  180
TAGGTMRNVP VGAGRRKNKS SASQFCHLTV PESLQSARVD LPNGVHHPVL NPNGTILAFS  240
SDAPLCESMV SVLDIADKTL RDGARNGFQK PAENGDDQSS GSSTTASSKD KVGQIGLPEL  300
IPNHHPFPPQ VPCFPGAPWP YPWPSVQWSS LVSAPAFGPA SFPLPFYSTA PPYWGCAVPG  360
AWNVPWVIPP APTSSQSHSS PSSSPNSPTL GKHSRDDNIL KPANSEEETR KESNSEKCLW  420
VPKTLRIDDP GEAAKSSIWA TLGIKNDRVD PVGGGGLFKA FGSQSKGDCK AQAPETSTVL  480
QANPAALSRS LSFHESS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085751.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLA0A068U1T10.0A0A068U1T1_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-99cycling DOF factor 2